Anti ATP6V1F pAb (ATL-HPA062011 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062011-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-ATP6V1F antibody. Corresponding ATP6V1F RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Gene Name: ATP6V1F
Alternative Gene Name: ATP6S14, VATF, Vma7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004285: 97%, ENSRNOG00000007392: 97%
Entrez Gene ID: 9296
Uniprot ID: Q16864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL
Gene Sequence DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL
Gene ID - Mouse ENSMUSG00000004285
Gene ID - Rat ENSRNOG00000007392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ATP6V1F pAb (ATL-HPA062011 w/enhanced validation)
Datasheet Anti ATP6V1F pAb (ATL-HPA062011 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP6V1F pAb (ATL-HPA062011 w/enhanced validation)