Anti ATP6V1F pAb (ATL-HPA048700)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048700-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATP6V1F
Alternative Gene Name: ATP6S14, VATF, Vma7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047810: 34%, ENSRNOG00000054336: 37%
Entrez Gene ID: 9296
Uniprot ID: Q16864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL |
Gene Sequence | DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL |
Gene ID - Mouse | ENSMUSG00000047810 |
Gene ID - Rat | ENSRNOG00000054336 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP6V1F pAb (ATL-HPA048700) | |
Datasheet | Anti ATP6V1F pAb (ATL-HPA048700) Datasheet (External Link) |
Vendor Page | Anti ATP6V1F pAb (ATL-HPA048700) at Atlas Antibodies |
Documents & Links for Anti ATP6V1F pAb (ATL-HPA048700) | |
Datasheet | Anti ATP6V1F pAb (ATL-HPA048700) Datasheet (External Link) |
Vendor Page | Anti ATP6V1F pAb (ATL-HPA048700) |