Anti ATP6V1C1 pAb (ATL-HPA057297)

Atlas Antibodies

Catalog No.:
ATL-HPA057297-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Gene Name: ATP6V1C1
Alternative Gene Name: ATP6C, ATP6D, VATC, Vma5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022295: 99%, ENSRNOG00000004846: 98%
Entrez Gene ID: 528
Uniprot ID: P21283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNR
Gene Sequence VVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNR
Gene ID - Mouse ENSMUSG00000022295
Gene ID - Rat ENSRNOG00000004846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP6V1C1 pAb (ATL-HPA057297)
Datasheet Anti ATP6V1C1 pAb (ATL-HPA057297) Datasheet (External Link)
Vendor Page Anti ATP6V1C1 pAb (ATL-HPA057297) at Atlas Antibodies

Documents & Links for Anti ATP6V1C1 pAb (ATL-HPA057297)
Datasheet Anti ATP6V1C1 pAb (ATL-HPA057297) Datasheet (External Link)
Vendor Page Anti ATP6V1C1 pAb (ATL-HPA057297)