Anti ATP6V1C1 pAb (ATL-HPA023943)

Atlas Antibodies

SKU: ATL-HPA023943-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Gene Name: ATP6V1C1
Alternative Gene Name: ATP6C, ATP6D, VATC, Vma5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022295: 97%, ENSRNOG00000004846: 97%
Entrez Gene ID: 528
Uniprot ID: P21283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC
• Gene Sequence: NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC
• Gene ID - Mouse: ENSMUSG00000022295
• Gene ID - Rat: ENSRNOG00000004846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.