Anti ATP6V1B2 pAb (ATL-HPA008147 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008147-25

• 
• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
Gene Name: ATP6V1B2
Alternative Gene Name: ATP6B2, HO57, VATB, Vma2, VPP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006273: 98%, ENSRNOG00000011891: 98%
Entrez Gene ID: 526
Uniprot ID: P21281
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
• Gene Sequence: MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
• Gene ID - Mouse: ENSMUSG00000006273
• Gene ID - Rat: ENSRNOG00000011891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP6V1B2 pAb (ATL-HPA008147 w/enhanced validation) – 1 Found

Frische, Sebastian; Chambrey, Régine; Trepiccione, Francesco; Zamani, Reza; Marcussen, Niels; Alexander, R Todd; Skjødt, Karsten; Svenningsen, Per; Dimke, Henrik. H(+)-ATPase B1 subunit localizes to thick ascending limb and distal convoluted tubule of rodent and human kidney. American Journal Of Physiology. Renal Physiology. 2018;315(3):F429-F444.