Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031847-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
Gene Name: ATP6V1B1
Alternative Gene Name: ATP6B1, RTA1B, VATB, Vma2, VPP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006269: 79%, ENSRNOG00000013573: 77%
Entrez Gene ID: 525
Uniprot ID: P15313
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
• Gene Sequence: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
• Gene ID - Mouse: ENSMUSG00000006269
• Gene ID - Rat: ENSRNOG00000013573
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) – 2 Found

Plasschaert, Lindsey W; Žilionis, Rapolas; Choo-Wing, Rayman; Savova, Virginia; Knehr, Judith; Roma, Guglielmo; Klein, Allon M; Jaffe, Aron B. A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. Nature. 2018;560(7718):377-381. 

Zachar, Rikke; Thiel, Steffen; Hansen, Søren; Henriksen, Maiken Lumby; Skjoedt, Mikkel-Ole; Skjodt, Karsten; Hamzaei, Zohra; Madsen, Kirsten; Lund, Lars; Hummler, Edith; Svenningsen, Per; Jensen, Boye Lagerbon. Mannan-binding lectin serine protease-2 (MASP-2) in human kidney and its relevance for proteolytic activation of the epithelial sodium channel. Scientific Reports. 2022;12(1):15955.