Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016938-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATP6V0D1
Alternative Gene Name: ATP6D, ATP6DV, P39, VATX, Vma6, VPATPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013160: 100%, ENSRNOG00000017235: 100%
Entrez Gene ID: 9114
Uniprot ID: P61421
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL |
| Gene Sequence | TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL |
| Gene ID - Mouse | ENSMUSG00000013160 |
| Gene ID - Rat | ENSRNOG00000017235 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) | |
| Datasheet | Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) | |
| Datasheet | Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) |
| Citations for Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) – 1 Found |
| Bao, Zhang; Chen, Ran; Zhang, Pei; Lu, Shan; Chen, Xing; Yao, Yake; Jin, Xiaozheng; Sun, Yilan; Zhou, Jianying. A potential target gene for the host-directed therapy of mycobacterial infection in murine macrophages. International Journal Of Molecular Medicine. 2016;38(3):823-33. PubMed |