Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA016938-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Gene Name: ATP6V0D1
Alternative Gene Name: ATP6D, ATP6DV, P39, VATX, Vma6, VPATPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013160: 100%, ENSRNOG00000017235: 100%
Entrez Gene ID: 9114
Uniprot ID: P61421
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL
• Gene Sequence: TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL
• Gene ID - Mouse: ENSMUSG00000013160
• Gene ID - Rat: ENSRNOG00000017235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP6V0D1 pAb (ATL-HPA016938 w/enhanced validation) – 1 Found

Bao, Zhang; Chen, Ran; Zhang, Pei; Lu, Shan; Chen, Xing; Yao, Yake; Jin, Xiaozheng; Sun, Yilan; Zhou, Jianying. A potential target gene for the host-directed therapy of mycobacterial infection in murine macrophages. International Journal Of Molecular Medicine. 2016;38(3):823-33.