Anti ATP6V0A1 pAb (ATL-HPA022144 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022144-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal V0 subunit a1
Gene Name: ATP6V0A1
Alternative Gene Name: a1, ATP6N1, ATP6N1A, Stv1, Vph1, VPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019302: 100%, ENSRNOG00000036814: 100%
Entrez Gene ID: 535
Uniprot ID: Q93050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
• Gene Sequence: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
• Gene ID - Mouse: ENSMUSG00000019302
• Gene ID - Rat: ENSRNOG00000036814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP6V0A1 pAb (ATL-HPA022144 w/enhanced validation) – 1 Found

Crummy, Ellen; Mani, Muralidharan; Thellman, John C; Martin, Thomas F J. The priming factor CAPS1 regulates dense-core vesicle acidification by interacting with rabconnectin3β/WDR7 in neuroendocrine cells. The Journal Of Biological Chemistry. 2019;294(24):9402-9415.