Anti ATP6AP2 pAb (ATL-HPA003156 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA003156-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal accessory protein 2
Gene Name: ATP6AP2
Alternative Gene Name: APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031007: 94%, ENSRNOG00000003858: 93%
Entrez Gene ID: 10159
Uniprot ID: O75787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
• Gene Sequence: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
• Gene ID - Mouse: ENSMUSG00000031007
• Gene ID - Rat: ENSRNOG00000003858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP6AP2 pAb (ATL-HPA003156 w/enhanced validation) – 47 Found

Kurlak, Lesia O; Mistry, Hiten D; Cindrova-Davies, Tereza; Burton, Graham J; Broughton Pipkin, Fiona. Human placental renin-angiotensin system in normotensive and pre-eclamptic pregnancies at high altitude and after acute hypoxia-reoxygenation insult. The Journal Of Physiology. 2016;594(5):1327-40. 

Siljee, Sam; Keane, Emily; Marsh, Reginald; Brasch, Helen D; Tan, Swee T; Itinteang, Tinte. Expression of the Components of the Renin-Angiotensin System in Venous Malformation. Frontiers In Surgery. 3( 27200356):24. 

Xiong, Lei; Jung, Ji-Ung; Guo, Hao-Han; Pan, Jin-Xiu; Sun, Xiang-Dong; Mei, Lin; Xiong, Wen-Cheng. Osteoblastic Lrp4 promotes osteoclastogenesis by regulating ATP release and adenosine-A(2A)R signaling. The Journal Of Cell Biology. 2017;216(3):761-778. 

Ram, Rachna S; Brasch, Helen D; Dunne, Jonathan C; Davis, Paul F; Tan, Swee T; Itinteang, Tinte. Cancer Stem Cells in Moderately Differentiated Lip Squamous Cell Carcinoma Express Components of the Renin-Angiotensin System. Frontiers In Surgery. 4( 28634582):30. 

On, Nicholas; Koh, Sabrina P; Brasch, Helen D; Dunne, Jonathan C; Armstrong, James R; Tan, Swee T; Itinteang, Tinte. Embryonic Stem Cell-Like Population in Dupuytren's Disease Expresses Components of the Renin-Angiotensin System. Plastic And Reconstructive Surgery. Global Open. 2017;5(7):e1422. 

Wendling, Olivia; Champy, Marie-France; Jaubert, Solène; Pavlovic, Guillaume; Dubos, Aline; Lindner, Loic; Jacobs, Hugues; Mark, Manuel; Combe, Roy; Da Cruz, Isabelle Goncalves; Luche, Hervé; Mudgett, John S; Rosahl, Thomas; Sorg, Tania; Malissen, Marie; Reilly, Patrick T; Hérault, Yann. Atp6ap2 ablation in adult mice impairs viability through multiple organ deficiencies. Scientific Reports. 2017;7(1):9618. 

Su, Jiahui; Liu, Xiyang; Xu, Chuanming; Lu, Xiaohan; Wang, Fei; Fang, Hui; Lu, Aihua; Qiu, Qixiang; Li, Chunling; Yang, Tianxin. NF-κB-dependent upregulation of (pro)renin receptor mediates high-NaCl-induced apoptosis in mouse inner medullary collecting duct cells. American Journal Of Physiology. Cell Physiology. 2017;313(6):C612-C620. 

Rujano, Maria A; Cannata Serio, Magda; Panasyuk, Ganna; Péanne, Romain; Reunert, Janine; Rymen, Daisy; Hauser, Virginie; Park, Julien H; Freisinger, Peter; Souche, Erika; Guida, Maria Clara; Maier, Esther M; Wada, Yoshinao; Jäger, Stefanie; Krogan, Nevan J; Kretz, Oliver; Nobre, Susana; Garcia, Paula; Quelhas, Dulce; Bird, Thomas D; Raskind, Wendy H; Schwake, Michael; Duvet, Sandrine; Foulquier, Francois; Matthijs, Gert; Marquardt, Thorsten; Simons, Matias. Mutations in the X-linked ATP6AP2 cause a glycosylation disorder with autophagic defects. The Journal Of Experimental Medicine. 2017;214(12):3707-3729. 

Seki, Yasufumi; Yatabe, Midori; Suda, Chikahito; Morimoto, Satoshi; Ichihara, Atsuhiro. Elevated (Pro)renin Receptor Expression Contributes to Maintaining Aerobic Metabolism in Growth Hormone Deficiency. Journal Of The Endocrine Society. 2018;2(3):252-265. 

Makdissy, Nehman; Haddad, Katia; AlBacha, Jeanne D'arc; Chaker, Diana; Ismail, Bassel; Azar, Albert; Oreibi, Ghada; Ayoub, David; Achkar, Ibrahim; Quilliot, Didier; Fajloun, Ziad. Essential role of ATP6AP2 enrichment in caveolae/lipid raft microdomains for the induction of neuronal differentiation of stem cells. Stem Cell Research & Therapy. 2018;9(1):132. 

Pareja, Fresia; Brandes, Alissa H; Basili, Thais; Selenica, Pier; Geyer, Felipe C; Fan, Dan; Da Cruz Paula, Arnaud; Kumar, Rahul; Brown, David N; Gularte-Mérida, Rodrigo; Alemar, Barbara; Bi, Rui; Lim, Raymond S; de Bruijn, Ino; Fujisawa, Sho; Gardner, Rui; Feng, Elvin; Li, Anqi; da Silva, Edaise M; Lozada, John R; Blecua, Pedro; Cohen-Gould, Leona; Jungbluth, Achim A; Rakha, Emad A; Ellis, Ian O; Edelweiss, Maria I A; Palazzo, Juan; Norton, Larry; Hollmann, Travis; Edelweiss, Marcia; Rubin, Brian P; Weigelt, Britta; Reis-Filho, Jorge S. Loss-of-function mutations in ATP6AP1 and ATP6AP2 in granular cell tumors. Nature Communications. 2018;9(1):3533. 

Papali'i-Curtin, Jessica C; Brasch, Helen D; van Schaijik, Bede; de Jongh, Jennifer; Marsh, Reginald W; Tan, Swee T; Itinteang, Tinte. Expression of Components of the Renin-Angiotensin System in Pyogenic Granuloma. Frontiers In Surgery. 6( 31024924):13. 

Reyes-Martinez, Cristian; Nguyen, Quynh My; Kassan, Modar; Gonzalez, Alexis A. (Pro)renin Receptor-Dependent Induction of Profibrotic Factors Is Mediated by COX-2/EP4/NOX-4/Smad Pathway in Collecting Duct Cells. Frontiers In Pharmacology. 10( 31396082):803. 

Li, Caixia; Matavelli, Luis C; Akhtar, Safia; Siragy, Helmy M. (Pro)renin receptor contributes to renal mitochondria dysfunction, apoptosis and fibrosis in diabetic mice. Scientific Reports. 2019;9(1):11667. 

Liu, Bing; Lan, Ming; Wei, Huali; Zhang, Dapeng; Liu, Junmeng; Teng, Jiwei. Downregulated microRNA‑133a induces HUVECs injury: Potential role of the (pro) renin receptor in angiotensin II‑dependent hypertension. Molecular Medicine Reports. 2019;20(3):2796-2804. 

Luo, Renfei; Yang, Kevin; Wang, Fei; Xu, Chuanming; Yang, Tianxin. (Pro)renin receptor decoy peptide PRO20 protects against adriamycin-induced nephropathy by targeting the intrarenal renin-angiotensin system. American Journal Of Physiology. Renal Physiology. 2020;319(5):F930-F940. 

Wang, Yan; Wang, Yurong; Xue, Kai; Wang, Huaijie; Zhou, Jingjing; Gao, Feng; Li, Chengde; Yang, Tianxin; Fang, Hui. (Pro)renin receptor antagonist PRO20 attenuates nephrectomy-induced nephropathy in rats via inhibition of intrarenal RAS and Wnt/β-catenin signaling. Physiological Reports. 2021;9(11):e14881. 

Gogulamudi, Venkateswara R; Arita, Danielle Y; Bourgeois, Camille R T; Jorgensen, Justine; He, Jing; Wimley, William C; Satou, Ryosuke; Gonzalez, Alexis A; Prieto, Minolfa C. High glucose induces trafficking of prorenin receptor and stimulates profibrotic factors in the collecting duct. Scientific Reports. 2021;11(1):13815. 

Larrinaga, Gorka; Calvete-Candenas, Julio; Solano-Iturri, Jon Danel; Martín, Ana M; Pueyo, Angel; Nunes-Xavier, Caroline E; Pulido, Rafael; Dorado, Juan F; López, José I; Angulo, Javier C. (Pro)renin Receptor Is a Novel Independent Prognostic Marker in Invasive Urothelial Carcinoma of the Bladder. Cancers. 2021;13(22) 

Lu, Aihua; Pu, Min; Mo, Shiqi; Su, Jiahui; Hu, Jiajia; Li, Chunling; Wang, Weidong; Yang, Tianxin. (Pro)renin Receptor Regulates Phosphate Homeostasis in Rats via Releasing Fibroblast Growth Factor-23. Frontiers In Physiology. 13( 35222071):784521. 

Prieto, Minolfa C; Williams, Dustyn E; Liu, Liu; Kavanagh, Kimberly L; Mullins, John J; Mitchell, Kenneth D. Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension. American Journal Of Physiology. Renal Physiology. 2011;300(2):F581-8. 

Gonzalez, Alexis A; Lara, Lucienne S; Luffman, Christina; Seth, Dale M; Prieto, Minolfa C. Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats. Hypertension (Dallas, Tex. : 1979). 2011;57(4):859-64. 

Zaade, Daniela; Schmitz, Jennifer; Benke, Eileen; Klare, Sabrina; Seidel, Kerstin; Kirsch, Sebastian; Goldin-Lang, Petra; Zollmann, Frank S; Unger, Thomas; Funke-Kaiser, Heiko. Distinct signal transduction pathways downstream of the (P)RR revealed by microarray and ChIP-chip analyses. Plos One. 8(3):e57674. 

Kirsch, Sebastian; Schrezenmeier, Eva; Klare, Sabrina; Zaade, Daniela; Seidel, Kerstin; Schmitz, Jennifer; Bernhard, Sarah; Lauer, Dilyara; Slack, Mark; Goldin-Lang, Petra; Unger, Thomas; Zollmann, Frank S; Funke-Kaiser, Heiko. The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein. International Journal Of Molecular Medicine. 2014;33(4):795-808. 

Gonzalez, Alexis A; Green, Torrance; Luffman, Christina; Bourgeois, Camille R T; Gabriel Navar, L; Prieto, Minolfa C. Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension. American Journal Of Physiology. Renal Physiology. 2014;307(8):F962-70. 

Gonzalez, Alexis A; Womack, Joel P; Liu, Liu; Seth, Dale M; Prieto, Minolfa C. Angiotensin II increases the expression of (pro)renin receptor during low-salt conditions. The American Journal Of The Medical Sciences. 2014;348(5):416-22. 

Kissing, Sandra; Hermsen, Christina; Repnik, Urska; Nesset, Cecilie Kåsi; von Bargen, Kristine; Griffiths, Gareth; Ichihara, Atsuhiro; Lee, Beth S; Schwake, Michael; De Brabander, Jef; Haas, Albert; Saftig, Paul. Vacuolar ATPase in phagosome-lysosome fusion. The Journal Of Biological Chemistry. 2015;290(22):14166-80. 

Itinteang, Tinte; Dunne, Jonathan C; Chibnall, Alice M; Brasch, Helen D; Davis, Paul F; Tan, Swee T. Cancer stem cells in moderately differentiated oral tongue squamous cell carcinoma express components of the renin-angiotensin system. Journal Of Clinical Pathology. 2016;69(10):942-5. 

Featherston, Therese; Yu, Helen H; Dunne, Jonathan C; Chibnall, Alice M; Brasch, Helen D; Davis, Paul F; Tan, Swee T; Itinteang, Tinte. Cancer Stem Cells in Moderately Differentiated Buccal Mucosal Squamous Cell Carcinoma Express Components of the Renin-Angiotensin System. Frontiers In Surgery. 3( 27730124):52. 

Gonzalez, Alexis A; Zamora, Leonardo; Reyes-Martinez, Cristian; Salinas-Parra, Nicolas; Roldan, Nicole; Cuevas, Catherina A; Figueroa, Stefanny; Gonzalez-Vergara, Alex; Prieto, Minolfa C. (Pro)renin receptor activation increases profibrotic markers and fibroblast-like phenotype through MAPK-dependent ROS formation in mouse renal collecting duct cells. Clinical And Experimental Pharmacology & Physiology. 2017;44(11):1134-1144. 

Fang, Hui; Xu, Chuanming; Lu, Aihua; Zou, Chang-Jiang; Xie, Shiying; Chen, Yanting; Zhou, Li; Liu, Mi; Wang, Lei; Wang, Weidong; Yang, Tianxin. (Pro)renin receptor mediates albumin-induced cellular responses: role of site-1 protease-derived soluble (pro)renin receptor in renal epithelial cells. American Journal Of Physiology. Cell Physiology. 2017;313(6):C632-C643. 

Salinas-Parra, Nicolás; Reyes-Martínez, Cristian; Prieto, Minolfa C; Gonzalez, Alexis A. Prostaglandin E(2) Induces Prorenin-Dependent Activation of (Pro)renin Receptor and Upregulation of Cyclooxygenase-2 in Collecting Duct Cells. The American Journal Of The Medical Sciences. 2017;354(3):310-318. 

Fang, Hui; Deng, Mokan; Zhang, Linlin; Lu, Aihua; Su, Jiahui; Xu, Chuanming; Zhou, Li; Wang, Lei; Ou, Jing-Song; Wang, Weidong; Yang, Tianxin. Role of (pro)renin receptor in albumin overload-induced nephropathy in rats. American Journal Of Physiology. Renal Physiology. 2018;315(6):F1759-F1768. 

Fu, Ziwei; Hu, Jiajia; Zhou, Li; Chen, Yanting; Deng, Mokan; Liu, Xiyang; Su, Jiahui; Lu, Aihua; Fu, Xiaodong; Yang, Tianxin. (Pro)renin receptor contributes to pregnancy-induced sodium-water retention in rats via activation of intrarenal RAAS and α-ENaC. American Journal Of Physiology. Renal Physiology. 2019;316(3):F530-F538. 

Liu, Jie; Zhou, Yafan; Liu, Yalan; Li, Lei; Chen, Yan; Liu, Yali; Feng, Yumei; Yosypiv, Ihor V; Song, Renfang; Peng, Hua. (Pro)renin receptor regulates lung development via the Wnt/β-catenin signaling pathway. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2019;317(2):L202-L211. 

Nardi, Francesca; Fitchev, Philip; Brooks, Kyrsten M; Franco, Omar E; Cheng, Kevin; Hayward, Simon W; Welte, Michael A; Crawford, Susan E. Lipid droplet velocity is a microenvironmental sensor of aggressive tumors regulated by V-ATPase and PEDF. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2019;99(12):1822-1834. 

Akhtar, Safia; Siragy, Helmy M. Pro-renin receptor suppresses mitochondrial biogenesis and function via AMPK/SIRT-1/ PGC-1α pathway in diabetic kidney. Plos One. 14(12):e0225728. 

Xu, Chuanming; Wang, Fei; Chen, Yanting; Xie, Shiying; Sng, Danielle; Reversade, Bruno; Yang, Tianxin. ELABELA antagonizes intrarenal renin-angiotensin system to lower blood pressure and protects against renal injury. American Journal Of Physiology. Renal Physiology. 2020;318(5):F1122-F1135. 

Feng, Ye; Peng, Kexin; Luo, Renfei; Wang, Fei; Yang, Tianxin. Site-1 Protease-Derived Soluble (Pro)Renin Receptor Contributes to Angiotensin II-Induced Hypertension in Mice. Hypertension (Dallas, Tex. : 1979). 2021;77(2):405-416. 

Siljee, Sam; Buchanan, Olivia; Brasch, Helen D; Bockett, Nicholas; Patel, Josie; Paterson, Erin; Purdie, Gordon L; Davis, Paul F; Itinteang, Tinte; Tan, Swee T. Cancer Stem Cells in Metastatic Head and Neck Cutaneous Squamous Cell Carcinoma Express Components of the Renin-Angiotensin System. Cells. 2021;10(2) 

Solano-Iturri, Jon Danel; Echevarría, Enrique; Unda, Miguel; Loizaga-Iriarte, Ana; Pérez-Fernández, Amparo; Angulo, Javier C; López, José I; Larrinaga, Gorka. Clinical Implications of (Pro)renin Receptor (PRR) Expression in Renal Tumours. Diagnostics (Basel, Switzerland). 2021;11(2) 

Chen, Yanting; Xu, Chuanming; Hu, Jiajia; Deng, Mokan; Qiu, Qixiang; Mo, Shiqi; Du, Yanhua; Yang, Tianxin. Diuretic Action of Apelin-13 Mediated by Inhibiting cAMP/PKA/sPRR Pathway. Frontiers In Physiology. 12( 33868005):642274. 

Akhtar, Safia; Culver, Silas A; Siragy, Helmy M. Novel regulation of renal gluconeogenesis by Atp6ap2 in response to high fat diet via PGC1-α/AKT-1 pathway. Scientific Reports. 2021;11(1):11367. 

Culver, Silas A; Akhtar, Safia; Rountree-Jablin, Callie; Keller, Susanna R; Cathro, Helen P; Gildea, John J; Siragy, Helmy M. Knockout of Nephron ATP6AP2 Impairs Proximal Tubule Function and Prevents High-Fat Diet-Induced Obesity in Male Mice. Endocrinology. 2021;162(12) 

Patel, Nehal R; K C, Rajan; Blanks, Avery; Li, Yisu; Prieto, Minolfa C; Meadows, Stryder M. Endothelial cell polarity and extracellular matrix composition require functional ATP6AP2 during developmental and pathological angiogenesis. Jci Insight. 2022;7(19) 

Wang, Juan; Ding, Yuwei; Li, Dan; Zhu, Ning; Nishiyama, Akira; Yuan, Ying. (Pro)renin receptor promotes colorectal cancer progression through inhibiting the NEDD4L-mediated Wnt3 ubiquitination and modulating gut microbiota. Cell Communication And Signaling : Ccs. 2023;21(1):2. 

Bloemeke, Nicolas; Meighen-Berger, Kevin; Hitzenberger, Manuel; Bach, Nina C; Parr, Marina; Coelho, Joao Pl; Frishman, Dmitrij; Zacharias, Martin; Sieber, Stephan A; Feige, Matthias J. Intramembrane client recognition potentiates the chaperone functions of calnexin. The Embo Journal. 2022;41(24):e110959.