Anti ATP5SL pAb (ATL-HPA041427 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041427-25
  • Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ATP5SL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413374).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATP5S-like
Gene Name: ATP5SL
Alternative Gene Name: FLJ10241
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057229: 58%, ENSRNOG00000020596: 54%
Entrez Gene ID: 55101
Uniprot ID: Q9NW81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDC
Gene Sequence FLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDC
Gene ID - Mouse ENSMUSG00000057229
Gene ID - Rat ENSRNOG00000020596
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ATP5SL pAb (ATL-HPA041427 w/enhanced validation)
Datasheet Anti ATP5SL pAb (ATL-HPA041427 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP5SL pAb (ATL-HPA041427 w/enhanced validation)