Anti ATP5S pAb (ATL-HPA062690)

Atlas Antibodies

Catalog No.: ATL-HPA062690-25

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
Gene Name: ATP5S
Alternative Gene Name: ATPW, HSU79253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054894: 73%, ENSRNOG00000004893: 72%
Entrez Gene ID: 27109
Uniprot ID: Q99766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDC
• Gene Sequence: AMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDC
• Gene ID - Mouse: ENSMUSG00000054894
• Gene ID - Rat: ENSRNOG00000004893
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.