Anti ATP5S pAb (ATL-HPA046967)

Atlas Antibodies

Catalog No.:
ATL-HPA046967-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
Gene Name: ATP5S
Alternative Gene Name: ATPW, HSU79253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054894: 67%, ENSRNOG00000004893: 66%
Entrez Gene ID: 27109
Uniprot ID: Q99766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC
Gene Sequence MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC
Gene ID - Mouse ENSMUSG00000054894
Gene ID - Rat ENSRNOG00000004893
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP5S pAb (ATL-HPA046967)
Datasheet Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link)
Vendor Page Anti ATP5S pAb (ATL-HPA046967) at Atlas Antibodies

Documents & Links for Anti ATP5S pAb (ATL-HPA046967)
Datasheet Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link)
Vendor Page Anti ATP5S pAb (ATL-HPA046967)