Anti ATP5S pAb (ATL-HPA046967)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046967-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ATP5S
Alternative Gene Name: ATPW, HSU79253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054894: 67%, ENSRNOG00000004893: 66%
Entrez Gene ID: 27109
Uniprot ID: Q99766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC |
Gene Sequence | MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC |
Gene ID - Mouse | ENSMUSG00000054894 |
Gene ID - Rat | ENSRNOG00000004893 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP5S pAb (ATL-HPA046967) | |
Datasheet | Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link) |
Vendor Page | Anti ATP5S pAb (ATL-HPA046967) at Atlas Antibodies |
Documents & Links for Anti ATP5S pAb (ATL-HPA046967) | |
Datasheet | Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link) |
Vendor Page | Anti ATP5S pAb (ATL-HPA046967) |