Anti ATP5S pAb (ATL-HPA046967)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046967-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ATP5S
Alternative Gene Name: ATPW, HSU79253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054894: 67%, ENSRNOG00000004893: 66%
Entrez Gene ID: 27109
Uniprot ID: Q99766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC |
| Gene Sequence | MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC |
| Gene ID - Mouse | ENSMUSG00000054894 |
| Gene ID - Rat | ENSRNOG00000004893 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP5S pAb (ATL-HPA046967) | |
| Datasheet | Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link) |
| Vendor Page | Anti ATP5S pAb (ATL-HPA046967) at Atlas Antibodies |
| Documents & Links for Anti ATP5S pAb (ATL-HPA046967) | |
| Datasheet | Anti ATP5S pAb (ATL-HPA046967) Datasheet (External Link) |
| Vendor Page | Anti ATP5S pAb (ATL-HPA046967) |