Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041394-100
  • Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-ATP5O antibody. Corresponding ATP5O RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
Gene Name: ATP5O
Alternative Gene Name: ATPO, OSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022956: 78%, ENSRNOG00000001991: 77%
Entrez Gene ID: 539
Uniprot ID: P48047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Gene Sequence LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Gene ID - Mouse ENSMUSG00000022956
Gene ID - Rat ENSRNOG00000001991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation)
Datasheet Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation)
Datasheet Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation)