Anti ATP5O pAb (ATL-HPA041394 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041394-100

Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
Gene Name: ATP5O
Alternative Gene Name: ATPO, OSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022956: 78%, ENSRNOG00000001991: 77%
Entrez Gene ID: 539
Uniprot ID: P48047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
• Gene Sequence: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
• Gene ID - Mouse: ENSMUSG00000022956
• Gene ID - Rat: ENSRNOG00000001991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.