Anti ATP5L pAb (ATL-HPA044629)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044629-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ATP5L
Alternative Gene Name: ATP5JG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038717: 78%, ENSRNOG00000028884: 72%
Entrez Gene ID: 10632
Uniprot ID: O75964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK |
Gene Sequence | AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK |
Gene ID - Mouse | ENSMUSG00000038717 |
Gene ID - Rat | ENSRNOG00000028884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP5L pAb (ATL-HPA044629) | |
Datasheet | Anti ATP5L pAb (ATL-HPA044629) Datasheet (External Link) |
Vendor Page | Anti ATP5L pAb (ATL-HPA044629) at Atlas Antibodies |
Documents & Links for Anti ATP5L pAb (ATL-HPA044629) | |
Datasheet | Anti ATP5L pAb (ATL-HPA044629) Datasheet (External Link) |
Vendor Page | Anti ATP5L pAb (ATL-HPA044629) |