Anti ATP5L pAb (ATL-HPA044629)

Atlas Antibodies

Catalog No.: ATL-HPA044629-25

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
Gene Name: ATP5L
Alternative Gene Name: ATP5JG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038717: 78%, ENSRNOG00000028884: 72%
Entrez Gene ID: 10632
Uniprot ID: O75964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK
• Gene Sequence: AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK
• Gene ID - Mouse: ENSMUSG00000038717
• Gene ID - Rat: ENSRNOG00000028884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.