Anti ATP5J pAb (ATL-HPA031069)

Atlas Antibodies

Catalog No.: ATL-HPA031069-25

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6
Gene Name: ATP5J
Alternative Gene Name: ATP5, ATP5A, ATPM, CF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022890: 81%, ENSRNOG00000001551: 77%
Entrez Gene ID: 522
Uniprot ID: P18859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIE
• Gene Sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIE
• Gene ID - Mouse: ENSMUSG00000022890
• Gene ID - Rat: ENSRNOG00000001551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP5J pAb (ATL-HPA031069) – 1 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.