Anti ATP5G2 pAb (ATL-HPA051469)

Atlas Antibodies

Catalog No.:
ATL-HPA051469-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Name: ATP5G2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062683: 57%, ENSRNOG00000015320: 58%
Entrez Gene ID: 517
Uniprot ID: Q06055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
Gene Sequence LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
Gene ID - Mouse ENSMUSG00000062683
Gene ID - Rat ENSRNOG00000015320
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP5G2 pAb (ATL-HPA051469)
Datasheet Anti ATP5G2 pAb (ATL-HPA051469) Datasheet (External Link)
Vendor Page Anti ATP5G2 pAb (ATL-HPA051469) at Atlas Antibodies

Documents & Links for Anti ATP5G2 pAb (ATL-HPA051469)
Datasheet Anti ATP5G2 pAb (ATL-HPA051469) Datasheet (External Link)
Vendor Page Anti ATP5G2 pAb (ATL-HPA051469)