Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046067-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
Gene Name: ATP5F1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000563: 81%, ENSRNOG00000046299: 79%
Entrez Gene ID: 515
Uniprot ID: P24539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKN
Gene Sequence QLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKN
Gene ID - Mouse ENSMUSG00000000563
Gene ID - Rat ENSRNOG00000046299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation)
Datasheet Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation)
Datasheet Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation)