Anti ATP5C1 pAb (ATL-HPA060949)

Atlas Antibodies

Catalog No.: ATL-HPA060949-25

Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
Gene Name: ATP5C1
Alternative Gene Name: ATP5C, ATP5CL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025781: 91%, ENSRNOG00000019223: 87%
Entrez Gene ID: 509
Uniprot ID: P36542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
• Gene Sequence: RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
• Gene ID - Mouse: ENSMUSG00000025781
• Gene ID - Rat: ENSRNOG00000019223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.