Anti ATP5C1 pAb (ATL-HPA060949)

Atlas Antibodies

Catalog No.:
ATL-HPA060949-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
Gene Name: ATP5C1
Alternative Gene Name: ATP5C, ATP5CL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025781: 91%, ENSRNOG00000019223: 87%
Entrez Gene ID: 509
Uniprot ID: P36542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
Gene Sequence RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
Gene ID - Mouse ENSMUSG00000025781
Gene ID - Rat ENSRNOG00000019223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP5C1 pAb (ATL-HPA060949)
Datasheet Anti ATP5C1 pAb (ATL-HPA060949) Datasheet (External Link)
Vendor Page Anti ATP5C1 pAb (ATL-HPA060949) at Atlas Antibodies

Documents & Links for Anti ATP5C1 pAb (ATL-HPA060949)
Datasheet Anti ATP5C1 pAb (ATL-HPA060949) Datasheet (External Link)
Vendor Page Anti ATP5C1 pAb (ATL-HPA060949)