Anti ATP5B pAb (ATL-HPA001528 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001528-25

• 
• 
• 

Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Gene Name: ATP5B
Alternative Gene Name: ATPSB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025393: 99%, ENSRNOG00000002840: 100%
Entrez Gene ID: 506
Uniprot ID: P06576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
• Gene Sequence: LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
• Gene ID - Mouse: ENSMUSG00000025393
• Gene ID - Rat: ENSRNOG00000002840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP5B pAb (ATL-HPA001528 w/enhanced validation) – 2 Found

Calzia, Daniela; Garbarino, Greta; Caicci, Federico; Pestarino, Mario; Manni, Lucia; Traverso, Carlo Enrico; Panfoli, Isabella; Candiani, Simona. Evidence of Oxidative Phosphorylation in Zebrafish Photoreceptor Outer Segments at Different Larval Stages. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2018;66(7):497-509. 

Muys, Bruna Rodrigues; Sousa, Josane F; Plaça, Jessica Rodrigues; de Araújo, Luíza Ferreira; Sarshad, Aishe A; Anastasakis, Dimitrios G; Wang, Xiantao; Li, Xiao Ling; de Molfetta, Greice Andreotti; Ramão, Anelisa; Lal, Ashish; Vidal, Daniel Onofre; Hafner, Markus; Silva, Wilson A. miR-450a Acts as a Tumor Suppressor in Ovarian Cancer by Regulating Energy Metabolism. Cancer Research. 2019;79(13):3294-3305.