Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001520-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ATP5B
Alternative Gene Name: ATPSB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025393: 95%, ENSRNOG00000002840: 95%
Entrez Gene ID: 506
Uniprot ID: P06576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD |
| Gene Sequence | TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD |
| Gene ID - Mouse | ENSMUSG00000025393 |
| Gene ID - Rat | ENSRNOG00000002840 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) | |
| Datasheet | Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) | |
| Datasheet | Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) |
| Citations for Anti ATP5B pAb (ATL-HPA001520 w/enhanced validation) – 10 Found |
| Shlevkov, Evgeny; Kramer, Tal; Schapansky, Jason; LaVoie, Matthew J; Schwarz, Thomas L. Miro phosphorylation sites regulate Parkin recruitment and mitochondrial motility. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(41):E6097-E6106. PubMed |
| Bezawork-Geleta, Ayenachew; Wen, He; Dong, LanFeng; Yan, Bing; Vider, Jelena; Boukalova, Stepana; Krobova, Linda; Vanova, Katerina; Zobalova, Renata; Sobol, Margarita; Hozak, Pavel; Novais, Silvia Magalhaes; Caisova, Veronika; Abaffy, Pavel; Naraine, Ravindra; Pang, Ying; Zaw, Thiri; Zhang, Ping; Sindelka, Radek; Kubista, Mikael; Zuryn, Steven; Molloy, Mark P; Berridge, Michael V; Pacak, Karel; Rohlena, Jakub; Park, Sunghyouk; Neuzil, Jiri. Alternative assembly of respiratory complex II connects energy stress to metabolic checkpoints. Nature Communications. 2018;9(1):2221. PubMed |
| Gustavsson, Elin; Ek, Sara; Steen, Johanna; Kristensson, Malin; Älgenäs, Cajsa; Uhlén, Mathias; Wingren, Christer; Ottosson, Jenny; Hober, Sophia; Borrebaeck, Carl A K. Surrogate antigens as targets for proteome-wide binder selection. New Biotechnology. 2011;28(4):302-11. PubMed |
| Björklund, My; Roos, Jeanette; Gogvadze, Vladimir; Shoshan, Maria. Resveratrol induces SIRT1- and energy-stress-independent inhibition of tumor cell regrowth after low-dose platinum treatment. Cancer Chemotherapy And Pharmacology. 2011;68(6):1459-67. PubMed |
| Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. PubMed |
| Ren, Lili; Ding, Siyuan; Song, Yanhua; Li, Bin; Ramanathan, Muthukumar; Co, Julia; Amieva, Manuel R; Khavari, Paul A; Greenberg, Harry B. Profiling of rotavirus 3'UTR-binding proteins reveals the ATP synthase subunit ATP5B as a host factor that supports late-stage virus replication. The Journal Of Biological Chemistry. 2019;294(15):5993-6006. PubMed |
| Kirschberg, Matthias; Heuser, Sandra; Marcuzzi, Gian Paolo; Hufbauer, Martin; Seeger, Jens Michael; Đukić, Anamaria; Tomaić, Vjekoslav; Majewski, Slawomir; Wagner, Steffen; Wittekindt, Claus; Würdemann, Nora; Klussmann, Jens Peter; Quaas, Alexander; Kashkar, Hamid; Akgül, Baki. ATP synthase modulation leads to an increase of spare respiratory capacity in HPV associated cancers. Scientific Reports. 2020;10(1):17339. PubMed |
| Bertola, Nadia; Degan, Paolo; Cappelli, Enrico; Ravera, Silvia. Mutated FANCA Gene Role in the Modulation of Energy Metabolism and Mitochondrial Dynamics in Head and Neck Squamous Cell Carcinoma. Cells. 2022;11(15) PubMed |
| Slater, Kayleigh; Bosch, Rosa; Smith, Kaelin Francis; Jahangir, Chowdhury Arif; Garcia-Mulero, Sandra; Rahman, Arman; O'Connell, Fiona; Piulats, Josep M; O'Neill, Valerie; Horgan, Noel; Coupland, Sarah E; O'Sullivan, Jacintha; Gallagher, William M; Villanueva, Alberto; Kennedy, Breandán N. 1,4-dihydroxy quininib modulates the secretome of uveal melanoma tumour explants and a marker of oxidative phosphorylation in a metastatic xenograft model. Frontiers In Medicine. 9( 36698840):1036322. PubMed |
| Bajzikova, Martina; Kovarova, Jaromira; Coelho, Ana R; Boukalova, Stepana; Oh, Sehyun; Rohlenova, Katerina; Svec, David; Hubackova, Sona; Endaya, Berwini; Judasova, Kristyna; Bezawork-Geleta, Ayenachew; Kluckova, Katarina; Chatre, Laurent; Zobalova, Renata; Novakova, Anna; Vanova, Katerina; Ezrova, Zuzana; Maghzal, Ghassan J; Magalhaes Novais, Silvia; Olsinova, Marie; Krobova, Linda; An, Yong Jin; Davidova, Eliska; Nahacka, Zuzana; Sobol, Margarita; Cunha-Oliveira, Teresa; Sandoval-Acuña, Cristian; Strnad, Hynek; Zhang, Tongchuan; Huynh, Thanh; Serafim, Teresa L; Hozak, Pavel; Sardao, Vilma A; Koopman, Werner J H; Ricchetti, Miria; Oliveira, Paulo J; Kolar, Frantisek; Kubista, Mikael; Truksa, Jaroslav; Dvorakova-Hortova, Katerina; Pacak, Karel; Gurlich, Robert; Stocker, Roland; Zhou, Yaoqi; Berridge, Michael V; Park, Sunghyouk; Dong, Lanfeng; Rohlena, Jakub; Neuzil, Jiri. Reactivation of Dihydroorotate Dehydrogenase-Driven Pyrimidine Biosynthesis Restores Tumor Growth of Respiration-Deficient Cancer Cells. Cell Metabolism. 2019;29(2):399-416.e10. PubMed |