Anti ATP4A pAb (ATL-HPA039154 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039154-25

• 

Protein Description: ATPase, H+/K+ exchanging, alpha polypeptide
Gene Name: ATP4A
Alternative Gene Name: ATP6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005553: 95%, ENSRNOG00000020985: 95%
Entrez Gene ID: 495
Uniprot ID: P20648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
• Gene Sequence: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
• Gene ID - Mouse: ENSMUSG00000005553
• Gene ID - Rat: ENSRNOG00000020985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP4A pAb (ATL-HPA039154 w/enhanced validation) – 1 Found

Puri, Pawan; Grimmett, Garfield; Faraj, Rawah; Gibson, Laurielle; Gilbreath, Ebony; Yoder, Bradley K. Elevated Protein Kinase A Activity in Stomach Mesenchyme Disrupts Mesenchymal-epithelial Crosstalk and Induces Preneoplasia. Cellular And Molecular Gastroenterology And Hepatology. 14(3):643-668.e1.