Anti ATP2C2 pAb (ATL-HPA052262)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052262-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 78%, ENSRNOG00000049334: 76%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ |
Gene Sequence | LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ |
Gene ID - Mouse | ENSMUSG00000034112 |
Gene ID - Rat | ENSRNOG00000049334 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP2C2 pAb (ATL-HPA052262) | |
Datasheet | Anti ATP2C2 pAb (ATL-HPA052262) Datasheet (External Link) |
Vendor Page | Anti ATP2C2 pAb (ATL-HPA052262) at Atlas Antibodies |
Documents & Links for Anti ATP2C2 pAb (ATL-HPA052262) | |
Datasheet | Anti ATP2C2 pAb (ATL-HPA052262) Datasheet (External Link) |
Vendor Page | Anti ATP2C2 pAb (ATL-HPA052262) |