Anti ATP2C2 pAb (ATL-HPA052262)

Atlas Antibodies

Catalog No.:
ATL-HPA052262-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, type 2C, member 2
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 78%, ENSRNOG00000049334: 76%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
Gene Sequence LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
Gene ID - Mouse ENSMUSG00000034112
Gene ID - Rat ENSRNOG00000049334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP2C2 pAb (ATL-HPA052262)
Datasheet Anti ATP2C2 pAb (ATL-HPA052262) Datasheet (External Link)
Vendor Page Anti ATP2C2 pAb (ATL-HPA052262) at Atlas Antibodies

Documents & Links for Anti ATP2C2 pAb (ATL-HPA052262)
Datasheet Anti ATP2C2 pAb (ATL-HPA052262) Datasheet (External Link)
Vendor Page Anti ATP2C2 pAb (ATL-HPA052262)