Anti ATP2C1 pAb (ATL-HPA035116)

Atlas Antibodies

Catalog No.: ATL-HPA035116-25

Protein Description: ATPase, Ca++ transporting, type 2C, member 1
Gene Name: ATP2C1
Alternative Gene Name: ATP2C1A, BCPM, KIAA1347, PMR1, SPCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032570: 92%, ENSRNOG00000013305: 94%
Entrez Gene ID: 27032
Uniprot ID: P98194
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
• Gene Sequence: AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
• Gene ID - Mouse: ENSMUSG00000032570
• Gene ID - Rat: ENSRNOG00000013305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP2C1 pAb (ATL-HPA035116) – 1 Found

Crevenna, Alvaro H; Blank, Birgit; Maiser, Andreas; Emin, Derya; Prescher, Jens; Beck, Gisela; Kienzle, Christine; Bartnik, Kira; Habermann, Bianca; Pakdel, Mehrshad; Leonhardt, Heinrich; Lamb, Don C; von Blume, Julia. Secretory cargo sorting by Ca2+-dependent Cab45 oligomerization at the trans-Golgi network. The Journal Of Cell Biology. 2016;213(3):305-14.