Anti ATP2C1 pAb (ATL-HPA035116)

Atlas Antibodies

Catalog No.:
ATL-HPA035116-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, type 2C, member 1
Gene Name: ATP2C1
Alternative Gene Name: ATP2C1A, BCPM, KIAA1347, PMR1, SPCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032570: 92%, ENSRNOG00000013305: 94%
Entrez Gene ID: 27032
Uniprot ID: P98194
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
Gene Sequence AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
Gene ID - Mouse ENSMUSG00000032570
Gene ID - Rat ENSRNOG00000013305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP2C1 pAb (ATL-HPA035116)
Datasheet Anti ATP2C1 pAb (ATL-HPA035116) Datasheet (External Link)
Vendor Page Anti ATP2C1 pAb (ATL-HPA035116) at Atlas Antibodies

Documents & Links for Anti ATP2C1 pAb (ATL-HPA035116)
Datasheet Anti ATP2C1 pAb (ATL-HPA035116) Datasheet (External Link)
Vendor Page Anti ATP2C1 pAb (ATL-HPA035116)
Citations for Anti ATP2C1 pAb (ATL-HPA035116) – 1 Found
Crevenna, Alvaro H; Blank, Birgit; Maiser, Andreas; Emin, Derya; Prescher, Jens; Beck, Gisela; Kienzle, Christine; Bartnik, Kira; Habermann, Bianca; Pakdel, Mehrshad; Leonhardt, Heinrich; Lamb, Don C; von Blume, Julia. Secretory cargo sorting by Ca2+-dependent Cab45 oligomerization at the trans-Golgi network. The Journal Of Cell Biology. 2016;213(3):305-14.  PubMed