Anti ATP2C1 pAb (ATL-HPA035116)
Atlas Antibodies
- SKU:
- ATL-HPA035116-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ATP2C1
Alternative Gene Name: ATP2C1A, BCPM, KIAA1347, PMR1, SPCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032570: 92%, ENSRNOG00000013305: 94%
Entrez Gene ID: 27032
Uniprot ID: P98194
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD |
Gene Sequence | AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD |
Gene ID - Mouse | ENSMUSG00000032570 |
Gene ID - Rat | ENSRNOG00000013305 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP2C1 pAb (ATL-HPA035116) | |
Datasheet | Anti ATP2C1 pAb (ATL-HPA035116) Datasheet (External Link) |
Vendor Page | Anti ATP2C1 pAb (ATL-HPA035116) at Atlas Antibodies |
Documents & Links for Anti ATP2C1 pAb (ATL-HPA035116) | |
Datasheet | Anti ATP2C1 pAb (ATL-HPA035116) Datasheet (External Link) |
Vendor Page | Anti ATP2C1 pAb (ATL-HPA035116) |
Citations for Anti ATP2C1 pAb (ATL-HPA035116) – 1 Found |
Crevenna, Alvaro H; Blank, Birgit; Maiser, Andreas; Emin, Derya; Prescher, Jens; Beck, Gisela; Kienzle, Christine; Bartnik, Kira; Habermann, Bianca; Pakdel, Mehrshad; Leonhardt, Heinrich; Lamb, Don C; von Blume, Julia. Secretory cargo sorting by Ca2+-dependent Cab45 oligomerization at the trans-Golgi network. The Journal Of Cell Biology. 2016;213(3):305-14. PubMed |