Anti ATP2B1 pAb (ATL-HPA011166 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011166-100
  • Immunohistochemistry analysis in human cerebral cortex and prostate tissues using HPA011166 antibody. Corresponding ATP2B1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & plasma membrane.
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, plasma membrane 1
Gene Name: ATP2B1
Alternative Gene Name: PMCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019943: 98%, ENSRNOG00000004026: 98%
Entrez Gene ID: 490
Uniprot ID: P20020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Gene Sequence DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Gene ID - Mouse ENSMUSG00000019943
Gene ID - Rat ENSRNOG00000004026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ATP2B1 pAb (ATL-HPA011166 w/enhanced validation)
Datasheet Anti ATP2B1 pAb (ATL-HPA011166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP2B1 pAb (ATL-HPA011166 w/enhanced validation)