Anti ATP2A3 pAb (ATL-HPA007180)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007180-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ATP2A3
Alternative Gene Name: SERCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020788: 90%, ENSRNOG00000017912: 89%
Entrez Gene ID: 489
Uniprot ID: Q93084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE |
| Gene Sequence | SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE |
| Gene ID - Mouse | ENSMUSG00000020788 |
| Gene ID - Rat | ENSRNOG00000017912 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP2A3 pAb (ATL-HPA007180) | |
| Datasheet | Anti ATP2A3 pAb (ATL-HPA007180) Datasheet (External Link) |
| Vendor Page | Anti ATP2A3 pAb (ATL-HPA007180) at Atlas Antibodies |
| Documents & Links for Anti ATP2A3 pAb (ATL-HPA007180) | |
| Datasheet | Anti ATP2A3 pAb (ATL-HPA007180) Datasheet (External Link) |
| Vendor Page | Anti ATP2A3 pAb (ATL-HPA007180) |