Anti ATP2A3 pAb (ATL-HPA007180)

Atlas Antibodies

Catalog No.:
ATL-HPA007180-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, ubiquitous
Gene Name: ATP2A3
Alternative Gene Name: SERCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020788: 90%, ENSRNOG00000017912: 89%
Entrez Gene ID: 489
Uniprot ID: Q93084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE
Gene Sequence SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE
Gene ID - Mouse ENSMUSG00000020788
Gene ID - Rat ENSRNOG00000017912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP2A3 pAb (ATL-HPA007180)
Datasheet Anti ATP2A3 pAb (ATL-HPA007180) Datasheet (External Link)
Vendor Page Anti ATP2A3 pAb (ATL-HPA007180) at Atlas Antibodies

Documents & Links for Anti ATP2A3 pAb (ATL-HPA007180)
Datasheet Anti ATP2A3 pAb (ATL-HPA007180) Datasheet (External Link)
Vendor Page Anti ATP2A3 pAb (ATL-HPA007180)