Anti ATP2A2 pAb (ATL-HPA062605 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062605-25
  • Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA062605 antibody. Corresponding ATP2A2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
Gene Name: ATP2A2
Alternative Gene Name: ATP2B, DAR, SERCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029467: 100%, ENSRNOG00000001285: 100%
Entrez Gene ID: 488
Uniprot ID: P16615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Gene Sequence TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Gene ID - Mouse ENSMUSG00000029467
Gene ID - Rat ENSRNOG00000001285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ATP2A2 pAb (ATL-HPA062605 w/enhanced validation)
Datasheet Anti ATP2A2 pAb (ATL-HPA062605 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP2A2 pAb (ATL-HPA062605 w/enhanced validation)



Citations for Anti ATP2A2 pAb (ATL-HPA062605 w/enhanced validation) – 2 Found
Amara, Venkateswara Rao; Surapaneni, Sunil Kumar; Tikoo, Kulbhushan. Dysregulation of microRNAs and renin-angiotensin system in high salt diet-induced cardiac dysfunction in uninephrectomized rats. Plos One. 12(7):e0180490.  PubMed
Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304.  PubMed