Anti ATP23 pAb (ATL-HPA035804)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035804-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ATP23
Alternative Gene Name: KUB3, XRCC6BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025436: 89%, ENSRNOG00000045629: 86%
Entrez Gene ID: 91419
Uniprot ID: Q9Y6H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI |
| Gene Sequence | CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI |
| Gene ID - Mouse | ENSMUSG00000025436 |
| Gene ID - Rat | ENSRNOG00000045629 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP23 pAb (ATL-HPA035804) | |
| Datasheet | Anti ATP23 pAb (ATL-HPA035804) Datasheet (External Link) |
| Vendor Page | Anti ATP23 pAb (ATL-HPA035804) at Atlas Antibodies |
| Documents & Links for Anti ATP23 pAb (ATL-HPA035804) | |
| Datasheet | Anti ATP23 pAb (ATL-HPA035804) Datasheet (External Link) |
| Vendor Page | Anti ATP23 pAb (ATL-HPA035804) |