Anti ATP23 pAb (ATL-HPA035804)

Atlas Antibodies

Catalog No.:
ATL-HPA035804-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP23 metallopeptidase and ATP synthase assembly factor homolog
Gene Name: ATP23
Alternative Gene Name: KUB3, XRCC6BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025436: 89%, ENSRNOG00000045629: 86%
Entrez Gene ID: 91419
Uniprot ID: Q9Y6H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI
Gene Sequence CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI
Gene ID - Mouse ENSMUSG00000025436
Gene ID - Rat ENSRNOG00000045629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP23 pAb (ATL-HPA035804)
Datasheet Anti ATP23 pAb (ATL-HPA035804) Datasheet (External Link)
Vendor Page Anti ATP23 pAb (ATL-HPA035804) at Atlas Antibodies

Documents & Links for Anti ATP23 pAb (ATL-HPA035804)
Datasheet Anti ATP23 pAb (ATL-HPA035804) Datasheet (External Link)
Vendor Page Anti ATP23 pAb (ATL-HPA035804)