Anti ATP1B1 pAb (ATL-HPA012911 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA012911-25

• 
• 

Protein Description: ATPase, Na+/K+ transporting, beta 1 polypeptide
Gene Name: ATP1B1
Alternative Gene Name: ATP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026576: 93%, ENSRNOG00000002934: 93%
Entrez Gene ID: 481
Uniprot ID: P05026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
• Gene Sequence: SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
• Gene ID - Mouse: ENSMUSG00000026576
• Gene ID - Rat: ENSRNOG00000002934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP1B1 pAb (ATL-HPA012911 w/enhanced validation) – 1 Found

Lee, Seung Joon; Litan, Alisa; Li, Zhiqin; Graves, Bruce; Lindsey, Stephan; Barwe, Sonali P; Langhans, Sigrid A. Na,K-ATPase β1-subunit is a target of sonic hedgehog signaling and enhances medulloblastoma tumorigenicity. Molecular Cancer. 2015;14( 26286140):159.