Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056446-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATPase, Na+/K+ transporting, alpha 3 polypeptide
Gene Name: ATP1A3
Alternative Gene Name: DYT12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040907: 100%, ENSRNOG00000020263: 100%
Entrez Gene ID: 478
Uniprot ID: P13637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Gene Sequence EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Gene ID - Mouse ENSMUSG00000040907
Gene ID - Rat ENSRNOG00000020263
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation)
Datasheet Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation)
Datasheet Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation)