Anti ATP13A1 pAb (ATL-HPA031798)

Atlas Antibodies

SKU: ATL-HPA031798-25

• 

Protein Description: ATPase type 13A1
Gene Name: ATP13A1
Alternative Gene Name: ATP13A, CGI-152, FLJ31858, KIAA1825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031862: 99%, ENSRNOG00000010776: 99%
Entrez Gene ID: 57130
Uniprot ID: Q9HD20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKTGTLTSDSLVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKDEKVFPRSIKTQGL
• Gene Sequence: DKTGTLTSDSLVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKDEKVFPRSIKTQGL
• Gene ID - Mouse: ENSMUSG00000031862
• Gene ID - Rat: ENSRNOG00000010776
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.