Anti ATP11B pAb (ATL-HPA036238)

Atlas Antibodies

SKU:
ATL-HPA036238-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase, class VI, type 11B
Gene Name: ATP11B
Alternative Gene Name: ATPIF, ATPIR, KIAA0956
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037400: 99%, ENSRNOG00000052116: 99%
Entrez Gene ID: 23200
Uniprot ID: Q9Y2G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRN
Gene Sequence ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRN
Gene ID - Mouse ENSMUSG00000037400
Gene ID - Rat ENSRNOG00000052116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP11B pAb (ATL-HPA036238)
Datasheet Anti ATP11B pAb (ATL-HPA036238) Datasheet (External Link)
Vendor Page Anti ATP11B pAb (ATL-HPA036238) at Atlas Antibodies

Documents & Links for Anti ATP11B pAb (ATL-HPA036238)
Datasheet Anti ATP11B pAb (ATL-HPA036238) Datasheet (External Link)
Vendor Page Anti ATP11B pAb (ATL-HPA036238)