Anti ATP11A pAb (ATL-HPA035584)

Atlas Antibodies

Catalog No.:
ATL-HPA035584-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATPase, class VI, type 11A
Gene Name: ATP11A
Alternative Gene Name: ATPIH, ATPIS, KIAA1021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031441: 88%, ENSRNOG00000017154: 90%
Entrez Gene ID: 23250
Uniprot ID: P98196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
Gene Sequence TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
Gene ID - Mouse ENSMUSG00000031441
Gene ID - Rat ENSRNOG00000017154
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP11A pAb (ATL-HPA035584)
Datasheet Anti ATP11A pAb (ATL-HPA035584) Datasheet (External Link)
Vendor Page Anti ATP11A pAb (ATL-HPA035584) at Atlas Antibodies

Documents & Links for Anti ATP11A pAb (ATL-HPA035584)
Datasheet Anti ATP11A pAb (ATL-HPA035584) Datasheet (External Link)
Vendor Page Anti ATP11A pAb (ATL-HPA035584)