Anti ATP11A pAb (ATL-HPA035583)

Atlas Antibodies

SKU: ATL-HPA035583-25

• 
• 

Protein Description: ATPase, class VI, type 11A
Gene Name: ATP11A
Alternative Gene Name: ATPIH, ATPIS, KIAA1021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031441: 88%, ENSRNOG00000017154: 88%
Entrez Gene ID: 23250
Uniprot ID: P98196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLG
• Gene Sequence: SATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLG
• Gene ID - Mouse: ENSMUSG00000031441
• Gene ID - Rat: ENSRNOG00000017154
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP11A pAb (ATL-HPA035583) – 1 Found

Chaubey, Pururawa Mayank; Hofstetter, Lia; Roschitzki, Bernd; Stieger, Bruno. Proteomic Analysis of the Rat Canalicular Membrane Reveals Expression of a Complex System of P4-ATPases in Liver. Plos One. 11(6):e0158033.