Anti ATP10A pAb (ATL-HPA042509)

Atlas Antibodies

SKU: ATL-HPA042509-25

• 

Protein Description: ATPase, class V, type 10A
Gene Name: ATP10A
Alternative Gene Name: ATP10C, ATPVA, ATPVC, KIAA0566
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025324: 83%, ENSRNOG00000056228: 81%
Entrez Gene ID: 57194
Uniprot ID: O60312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLS
• Gene Sequence: DSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLS
• Gene ID - Mouse: ENSMUSG00000025324
• Gene ID - Rat: ENSRNOG00000056228
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.