Anti ATL3 pAb (ATL-HPA065702)

Atlas Antibodies

Catalog No.:
ATL-HPA065702-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: atlastin GTPase 3
Gene Name: ATL3
Alternative Gene Name: DKFZP564J0863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024759: 81%, ENSRNOG00000021203: 58%
Entrez Gene ID: 25923
Uniprot ID: Q6DD88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFEL
Gene Sequence RVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFEL
Gene ID - Mouse ENSMUSG00000024759
Gene ID - Rat ENSRNOG00000021203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATL3 pAb (ATL-HPA065702)
Datasheet Anti ATL3 pAb (ATL-HPA065702) Datasheet (External Link)
Vendor Page Anti ATL3 pAb (ATL-HPA065702) at Atlas Antibodies

Documents & Links for Anti ATL3 pAb (ATL-HPA065702)
Datasheet Anti ATL3 pAb (ATL-HPA065702) Datasheet (External Link)
Vendor Page Anti ATL3 pAb (ATL-HPA065702)
Citations for Anti ATL3 pAb (ATL-HPA065702) – 1 Found
Monel, Blandine; Rajah, Maaran Michael; Hafirassou, Mohamed Lamine; Sid Ahmed, Samy; Burlaud-Gaillard, Julien; Zhu, Peng-Peng; Nevers, Quentin; Buchrieser, Julian; Porrot, Françoise; Meunier, Cécile; Amraoui, Sonia; Chazal, Maxime; Salles, Audrey; Jouvenet, Nolwenn; Roingeard, Philippe; Blackstone, Craig; Amara, Ali; Schwartz, Olivier. Atlastin Endoplasmic Reticulum-Shaping Proteins Facilitate Zika Virus Replication. Journal Of Virology. 2019;93(23)  PubMed