Anti ATL3 pAb (ATL-HPA065702)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065702-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ATL3
Alternative Gene Name: DKFZP564J0863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024759: 81%, ENSRNOG00000021203: 58%
Entrez Gene ID: 25923
Uniprot ID: Q6DD88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFEL |
| Gene Sequence | RVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFEL |
| Gene ID - Mouse | ENSMUSG00000024759 |
| Gene ID - Rat | ENSRNOG00000021203 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATL3 pAb (ATL-HPA065702) | |
| Datasheet | Anti ATL3 pAb (ATL-HPA065702) Datasheet (External Link) |
| Vendor Page | Anti ATL3 pAb (ATL-HPA065702) at Atlas Antibodies |
| Documents & Links for Anti ATL3 pAb (ATL-HPA065702) | |
| Datasheet | Anti ATL3 pAb (ATL-HPA065702) Datasheet (External Link) |
| Vendor Page | Anti ATL3 pAb (ATL-HPA065702) |
| Citations for Anti ATL3 pAb (ATL-HPA065702) – 1 Found |
| Monel, Blandine; Rajah, Maaran Michael; Hafirassou, Mohamed Lamine; Sid Ahmed, Samy; Burlaud-Gaillard, Julien; Zhu, Peng-Peng; Nevers, Quentin; Buchrieser, Julian; Porrot, Françoise; Meunier, Cécile; Amraoui, Sonia; Chazal, Maxime; Salles, Audrey; Jouvenet, Nolwenn; Roingeard, Philippe; Blackstone, Craig; Amara, Ali; Schwartz, Olivier. Atlastin Endoplasmic Reticulum-Shaping Proteins Facilitate Zika Virus Replication. Journal Of Virology. 2019;93(23) PubMed |