Anti ATL2 pAb (ATL-HPA075302)

Atlas Antibodies

Catalog No.:
ATL-HPA075302-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: atlastin GTPase 2
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 92%, ENSRNOG00000006523: 87%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ
Gene Sequence RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ
Gene ID - Mouse ENSMUSG00000059811
Gene ID - Rat ENSRNOG00000006523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATL2 pAb (ATL-HPA075302)
Datasheet Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link)
Vendor Page Anti ATL2 pAb (ATL-HPA075302) at Atlas Antibodies

Documents & Links for Anti ATL2 pAb (ATL-HPA075302)
Datasheet Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link)
Vendor Page Anti ATL2 pAb (ATL-HPA075302)