Anti ATL2 pAb (ATL-HPA075302)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075302-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 92%, ENSRNOG00000006523: 87%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ |
| Gene Sequence | RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ |
| Gene ID - Mouse | ENSMUSG00000059811 |
| Gene ID - Rat | ENSRNOG00000006523 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATL2 pAb (ATL-HPA075302) | |
| Datasheet | Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link) |
| Vendor Page | Anti ATL2 pAb (ATL-HPA075302) at Atlas Antibodies |
| Documents & Links for Anti ATL2 pAb (ATL-HPA075302) | |
| Datasheet | Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link) |
| Vendor Page | Anti ATL2 pAb (ATL-HPA075302) |