Anti ATL2 pAb (ATL-HPA029108)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029108-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 41%, ENSRNOG00000006523: 40%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK |
Gene Sequence | EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK |
Gene ID - Mouse | ENSMUSG00000059811 |
Gene ID - Rat | ENSRNOG00000006523 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATL2 pAb (ATL-HPA029108) | |
Datasheet | Anti ATL2 pAb (ATL-HPA029108) Datasheet (External Link) |
Vendor Page | Anti ATL2 pAb (ATL-HPA029108) at Atlas Antibodies |
Documents & Links for Anti ATL2 pAb (ATL-HPA029108) | |
Datasheet | Anti ATL2 pAb (ATL-HPA029108) Datasheet (External Link) |
Vendor Page | Anti ATL2 pAb (ATL-HPA029108) |