Anti ATG9A pAb (ATL-HPA059551)

Atlas Antibodies

SKU:
ATL-HPA059551-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: autophagy related 9A
Gene Name: ATG9A
Alternative Gene Name: APG9L1, FLJ22169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033124: 100%, ENSRNOG00000018975: 100%
Entrez Gene ID: 79065
Uniprot ID: Q7Z3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Gene Sequence IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Gene ID - Mouse ENSMUSG00000033124
Gene ID - Rat ENSRNOG00000018975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATG9A pAb (ATL-HPA059551)
Datasheet Anti ATG9A pAb (ATL-HPA059551) Datasheet (External Link)
Vendor Page Anti ATG9A pAb (ATL-HPA059551) at Atlas Antibodies

Documents & Links for Anti ATG9A pAb (ATL-HPA059551)
Datasheet Anti ATG9A pAb (ATL-HPA059551) Datasheet (External Link)
Vendor Page Anti ATG9A pAb (ATL-HPA059551)