Anti ATG7 pAb (ATL-HPA007639)

Atlas Antibodies

SKU: ATL-HPA007639-25

• 
• 

Protein Description: autophagy related 7
Gene Name: ATG7
Alternative Gene Name: APG7L, DKFZp434N0735, GSA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030314: 88%, ENSRNOG00000007486: 90%
Entrez Gene ID: 10533
Uniprot ID: O95352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
• Gene Sequence: EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
• Gene ID - Mouse: ENSMUSG00000030314
• Gene ID - Rat: ENSRNOG00000007486
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATG7 pAb (ATL-HPA007639) – 1 Found

Chu, Qiang; Zhang, Shuang; Chen, Meng; Han, Wen; Jia, Ruoyi; Chen, Wen; Zheng, Xiaodong. Cherry Anthocyanins Regulate NAFLD by Promoting Autophagy Pathway. Oxidative Medicine And Cellular Longevity. 2019( 30931080):4825949.