Anti ATG4D pAb (ATL-HPA067683)

Atlas Antibodies

Catalog No.:
ATL-HPA067683-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: autophagy related 4D, cysteine peptidase
Gene Name: ATG4D
Alternative Gene Name: APG4-D, APG4D, AUTL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002820: 90%, ENSRNOG00000047625: 94%
Entrez Gene ID: 84971
Uniprot ID: Q86TL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV
Gene Sequence LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV
Gene ID - Mouse ENSMUSG00000002820
Gene ID - Rat ENSRNOG00000047625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATG4D pAb (ATL-HPA067683)
Datasheet Anti ATG4D pAb (ATL-HPA067683) Datasheet (External Link)
Vendor Page Anti ATG4D pAb (ATL-HPA067683) at Atlas Antibodies

Documents & Links for Anti ATG4D pAb (ATL-HPA067683)
Datasheet Anti ATG4D pAb (ATL-HPA067683) Datasheet (External Link)
Vendor Page Anti ATG4D pAb (ATL-HPA067683)