Anti ATG4A pAb (ATL-HPA064759)

Atlas Antibodies

Catalog No.:
ATL-HPA064759-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: autophagy related 4A, cysteine peptidase
Gene Name: ATG4A
Alternative Gene Name: APG4A, AUTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079418: 91%, ENSRNOG00000050960: 88%
Entrez Gene ID: 115201
Uniprot ID: Q8WYN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
Gene Sequence ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
Gene ID - Mouse ENSMUSG00000079418
Gene ID - Rat ENSRNOG00000050960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATG4A pAb (ATL-HPA064759)
Datasheet Anti ATG4A pAb (ATL-HPA064759) Datasheet (External Link)
Vendor Page Anti ATG4A pAb (ATL-HPA064759) at Atlas Antibodies

Documents & Links for Anti ATG4A pAb (ATL-HPA064759)
Datasheet Anti ATG4A pAb (ATL-HPA064759) Datasheet (External Link)
Vendor Page Anti ATG4A pAb (ATL-HPA064759)