Anti ATG4A pAb (ATL-HPA064759)

Atlas Antibodies

Catalog No.: ATL-HPA064759-25

Protein Description: autophagy related 4A, cysteine peptidase
Gene Name: ATG4A
Alternative Gene Name: APG4A, AUTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079418: 91%, ENSRNOG00000050960: 88%
Entrez Gene ID: 115201
Uniprot ID: Q8WYN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
• Gene Sequence: ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
• Gene ID - Mouse: ENSMUSG00000079418
• Gene ID - Rat: ENSRNOG00000050960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.