Anti ATG4A pAb (ATL-HPA036374)

Atlas Antibodies

SKU:
ATL-HPA036374-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: autophagy related 4A, cysteine peptidase
Gene Name: ATG4A
Alternative Gene Name: APG4A, AUTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087119: 96%, ENSRNOG00000050960: 91%
Entrez Gene ID: 115201
Uniprot ID: Q8WYN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Gene Sequence QSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Gene ID - Mouse ENSMUSG00000087119
Gene ID - Rat ENSRNOG00000050960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATG4A pAb (ATL-HPA036374)
Datasheet Anti ATG4A pAb (ATL-HPA036374) Datasheet (External Link)
Vendor Page Anti ATG4A pAb (ATL-HPA036374) at Atlas Antibodies

Documents & Links for Anti ATG4A pAb (ATL-HPA036374)
Datasheet Anti ATG4A pAb (ATL-HPA036374) Datasheet (External Link)
Vendor Page Anti ATG4A pAb (ATL-HPA036374)