Anti ATG2A pAb (ATL-HPA038715)

Atlas Antibodies

Catalog No.:
ATL-HPA038715-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: autophagy related 2A
Gene Name: ATG2A
Alternative Gene Name: KIAA0404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106907: 76%, ENSRNOG00000060707: 73%
Entrez Gene ID: 23130
Uniprot ID: Q2TAZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM
Gene Sequence EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM
Gene ID - Mouse ENSMUSG00000106907
Gene ID - Rat ENSRNOG00000060707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATG2A pAb (ATL-HPA038715)
Datasheet Anti ATG2A pAb (ATL-HPA038715) Datasheet (External Link)
Vendor Page Anti ATG2A pAb (ATL-HPA038715) at Atlas Antibodies

Documents & Links for Anti ATG2A pAb (ATL-HPA038715)
Datasheet Anti ATG2A pAb (ATL-HPA038715) Datasheet (External Link)
Vendor Page Anti ATG2A pAb (ATL-HPA038715)