Anti ATG16L2 pAb (ATL-HPA050312)

Atlas Antibodies

Catalog No.:
ATL-HPA050312-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: autophagy related 16-like 2
Gene Name: ATG16L2
Alternative Gene Name: ATG16B, FLJ00012, WDR80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047767: 97%, ENSRNOG00000019413: 97%
Entrez Gene ID: 89849
Uniprot ID: Q8NAA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSGHKDKVTAAKFKLTRHQAVTGS
Gene Sequence LLATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSGHKDKVTAAKFKLTRHQAVTGS
Gene ID - Mouse ENSMUSG00000047767
Gene ID - Rat ENSRNOG00000019413
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATG16L2 pAb (ATL-HPA050312)
Datasheet Anti ATG16L2 pAb (ATL-HPA050312) Datasheet (External Link)
Vendor Page Anti ATG16L2 pAb (ATL-HPA050312) at Atlas Antibodies

Documents & Links for Anti ATG16L2 pAb (ATL-HPA050312)
Datasheet Anti ATG16L2 pAb (ATL-HPA050312) Datasheet (External Link)
Vendor Page Anti ATG16L2 pAb (ATL-HPA050312)