Anti ATG101 pAb (ATL-HPA039904)

Atlas Antibodies

Catalog No.: ATL-HPA039904-25

Protein Description: autophagy related 101
Gene Name: ATG101
Alternative Gene Name: C12orf44, FLJ11773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037204: 97%, ENSRNOG00000007756: 96%
Entrez Gene ID: 60673
Uniprot ID: Q9BSB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
• Gene Sequence: VGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
• Gene ID - Mouse: ENSMUSG00000037204
• Gene ID - Rat: ENSRNOG00000007756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.