Anti ATF7 pAb (ATL-HPA003384)

Atlas Antibodies

SKU: ATL-HPA003384-25

• 

Protein Description: activating transcription factor 7
Gene Name: ATF7
Alternative Gene Name: ATFA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099083: 98%, ENSRNOG00000015269: 98%
Entrez Gene ID: 11016
Uniprot ID: P17544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
• Gene Sequence: LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
• Gene ID - Mouse: ENSMUSG00000099083
• Gene ID - Rat: ENSRNOG00000015269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATF7 pAb (ATL-HPA003384) – 1 Found

Hasegawa, Hitomi; Ishibashi, Kenichi; Kubota, Shoichi; Yamaguchi, Chihiro; Yuki, Ryuzaburo; Nakajo, Haruna; Eckner, Richard; Yamaguchi, Noritaka; Yokoyama, Kazunari K; Yamaguchi, Naoto. Cdk1-mediated phosphorylation of human ATF7 at Thr-51 and Thr-53 promotes cell-cycle progression into M phase. Plos One. 9(12):e116048.