Anti ATF7 pAb (ATL-HPA003384)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003384-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ATF7
Alternative Gene Name: ATFA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099083: 98%, ENSRNOG00000015269: 98%
Entrez Gene ID: 11016
Uniprot ID: P17544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE |
| Gene Sequence | LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE |
| Gene ID - Mouse | ENSMUSG00000099083 |
| Gene ID - Rat | ENSRNOG00000015269 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATF7 pAb (ATL-HPA003384) | |
| Datasheet | Anti ATF7 pAb (ATL-HPA003384) Datasheet (External Link) |
| Vendor Page | Anti ATF7 pAb (ATL-HPA003384) at Atlas Antibodies |
| Documents & Links for Anti ATF7 pAb (ATL-HPA003384) | |
| Datasheet | Anti ATF7 pAb (ATL-HPA003384) Datasheet (External Link) |
| Vendor Page | Anti ATF7 pAb (ATL-HPA003384) |
| Citations for Anti ATF7 pAb (ATL-HPA003384) – 1 Found |
| Hasegawa, Hitomi; Ishibashi, Kenichi; Kubota, Shoichi; Yamaguchi, Chihiro; Yuki, Ryuzaburo; Nakajo, Haruna; Eckner, Richard; Yamaguchi, Noritaka; Yokoyama, Kazunari K; Yamaguchi, Naoto. Cdk1-mediated phosphorylation of human ATF7 at Thr-51 and Thr-53 promotes cell-cycle progression into M phase. Plos One. 9(12):e116048. PubMed |