Anti ATF1 pAb (ATL-HPA055406)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055406-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ATF1
Alternative Gene Name: TREB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023027: 97%, ENSRNOG00000061088: 97%
Entrez Gene ID: 466
Uniprot ID: P18846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDD |
Gene Sequence | TYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDD |
Gene ID - Mouse | ENSMUSG00000023027 |
Gene ID - Rat | ENSRNOG00000061088 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATF1 pAb (ATL-HPA055406) | |
Datasheet | Anti ATF1 pAb (ATL-HPA055406) Datasheet (External Link) |
Vendor Page | Anti ATF1 pAb (ATL-HPA055406) at Atlas Antibodies |
Documents & Links for Anti ATF1 pAb (ATL-HPA055406) | |
Datasheet | Anti ATF1 pAb (ATL-HPA055406) Datasheet (External Link) |
Vendor Page | Anti ATF1 pAb (ATL-HPA055406) |