Anti ATF1 pAb (ATL-HPA055406)

Atlas Antibodies

Catalog No.:
ATL-HPA055406-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: activating transcription factor 1
Gene Name: ATF1
Alternative Gene Name: TREB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023027: 97%, ENSRNOG00000061088: 97%
Entrez Gene ID: 466
Uniprot ID: P18846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDD
Gene Sequence TYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDD
Gene ID - Mouse ENSMUSG00000023027
Gene ID - Rat ENSRNOG00000061088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATF1 pAb (ATL-HPA055406)
Datasheet Anti ATF1 pAb (ATL-HPA055406) Datasheet (External Link)
Vendor Page Anti ATF1 pAb (ATL-HPA055406) at Atlas Antibodies

Documents & Links for Anti ATF1 pAb (ATL-HPA055406)
Datasheet Anti ATF1 pAb (ATL-HPA055406) Datasheet (External Link)
Vendor Page Anti ATF1 pAb (ATL-HPA055406)