Anti ATE1 pAb (ATL-HPA038444)

Atlas Antibodies

SKU:
ATL-HPA038444-25
  • Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: arginyltransferase 1
Gene Name: ATE1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030850: 70%, ENSRNOG00000024414: 80%
Entrez Gene ID: 11101
Uniprot ID: O95260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPK
Gene Sequence DFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPK
Gene ID - Mouse ENSMUSG00000030850
Gene ID - Rat ENSRNOG00000024414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATE1 pAb (ATL-HPA038444)
Datasheet Anti ATE1 pAb (ATL-HPA038444) Datasheet (External Link)
Vendor Page Anti ATE1 pAb (ATL-HPA038444) at Atlas Antibodies

Documents & Links for Anti ATE1 pAb (ATL-HPA038444)
Datasheet Anti ATE1 pAb (ATL-HPA038444) Datasheet (External Link)
Vendor Page Anti ATE1 pAb (ATL-HPA038444)