Anti ATAT1 pAb (ATL-HPA046816)

Atlas Antibodies

Catalog No.: ATL-HPA046816-25

Protein Description: alpha tubulin acetyltransferase 1
Gene Name: ATAT1
Alternative Gene Name: C6orf134, Em:AB023049.7, FLJ13158, MEC17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024426: 97%, ENSRNOG00000000809: 99%
Entrez Gene ID: 79969
Uniprot ID: Q5SQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFE
• Gene Sequence: EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFE
• Gene ID - Mouse: ENSMUSG00000024426
• Gene ID - Rat: ENSRNOG00000000809
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATAT1 pAb (ATL-HPA046816) – 3 Found

Even, Aviel; Morelli, Giovanni; Broix, Loïc; Scaramuzzino, Chiara; Turchetto, Silvia; Gladwyn-Ng, Ivan; Le Bail, Romain; Shilian, Michal; Freeman, Stephen; Magiera, Maria M; Jijumon, A S; Krusy, Nathalie; Malgrange, Brigitte; Brone, Bert; Dietrich, Paula; Dragatsis, Ioannis; Janke, Carsten; Saudou, Frédéric; Weil, Miguel; Nguyen, Laurent. ATAT1-enriched vesicles promote microtubule acetylation via axonal transport. Science Advances. 2019;5(12):eaax2705. 

Singh, Harinder; Chmura, Justyna; Bhaumik, Runa; Pandey, Ghanshyam N; Rasenick, Mark M. Membrane-Associated α-Tubulin Is Less Acetylated in Postmortem Prefrontal Cortex from Depressed Subjects Relative to Controls: Cytoskeletal Dynamics, HDAC6, and Depression. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(20):4033-4041. 

Kershaw, Stephen; Morgan, David J; Boyd, James; Spiller, David G; Kitchen, Gareth; Zindy, Egor; Iqbal, Mudassar; Rattray, Magnus; Sanderson, Christopher M; Brass, Andrew; Jorgensen, Claus; Hussell, Tracy; Matthews, Laura C; Ray, David W. Glucocorticoids rapidly inhibit cell migration through a novel, non-transcriptional HDAC6 pathway. Journal Of Cell Science. 2020;133(11)