Anti ATAT1 pAb (ATL-HPA046816)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046816-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ATAT1
Alternative Gene Name: C6orf134, Em:AB023049.7, FLJ13158, MEC17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024426: 97%, ENSRNOG00000000809: 99%
Entrez Gene ID: 79969
Uniprot ID: Q5SQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFE |
| Gene Sequence | EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFE |
| Gene ID - Mouse | ENSMUSG00000024426 |
| Gene ID - Rat | ENSRNOG00000000809 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATAT1 pAb (ATL-HPA046816) | |
| Datasheet | Anti ATAT1 pAb (ATL-HPA046816) Datasheet (External Link) |
| Vendor Page | Anti ATAT1 pAb (ATL-HPA046816) at Atlas Antibodies |
| Documents & Links for Anti ATAT1 pAb (ATL-HPA046816) | |
| Datasheet | Anti ATAT1 pAb (ATL-HPA046816) Datasheet (External Link) |
| Vendor Page | Anti ATAT1 pAb (ATL-HPA046816) |
| Citations for Anti ATAT1 pAb (ATL-HPA046816) – 3 Found |
| Even, Aviel; Morelli, Giovanni; Broix, Loïc; Scaramuzzino, Chiara; Turchetto, Silvia; Gladwyn-Ng, Ivan; Le Bail, Romain; Shilian, Michal; Freeman, Stephen; Magiera, Maria M; Jijumon, A S; Krusy, Nathalie; Malgrange, Brigitte; Brone, Bert; Dietrich, Paula; Dragatsis, Ioannis; Janke, Carsten; Saudou, Frédéric; Weil, Miguel; Nguyen, Laurent. ATAT1-enriched vesicles promote microtubule acetylation via axonal transport. Science Advances. 2019;5(12):eaax2705. PubMed |
| Singh, Harinder; Chmura, Justyna; Bhaumik, Runa; Pandey, Ghanshyam N; Rasenick, Mark M. Membrane-Associated α-Tubulin Is Less Acetylated in Postmortem Prefrontal Cortex from Depressed Subjects Relative to Controls: Cytoskeletal Dynamics, HDAC6, and Depression. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(20):4033-4041. PubMed |
| Kershaw, Stephen; Morgan, David J; Boyd, James; Spiller, David G; Kitchen, Gareth; Zindy, Egor; Iqbal, Mudassar; Rattray, Magnus; Sanderson, Christopher M; Brass, Andrew; Jorgensen, Claus; Hussell, Tracy; Matthews, Laura C; Ray, David W. Glucocorticoids rapidly inhibit cell migration through a novel, non-transcriptional HDAC6 pathway. Journal Of Cell Science. 2020;133(11) PubMed |