Anti ATAD3A pAb (ATL-HPA065305)

Atlas Antibodies

Catalog No.:
ATL-HPA065305-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATPase family, AAA domain containing 3A
Gene Name: ATAD3A
Alternative Gene Name: FLJ10709
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029036: 95%, ENSRNOG00000018118: 95%
Entrez Gene ID: 55210
Uniprot ID: Q9NVI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRR
Gene Sequence KLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRR
Gene ID - Mouse ENSMUSG00000029036
Gene ID - Rat ENSRNOG00000018118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATAD3A pAb (ATL-HPA065305)
Datasheet Anti ATAD3A pAb (ATL-HPA065305) Datasheet (External Link)
Vendor Page Anti ATAD3A pAb (ATL-HPA065305) at Atlas Antibodies

Documents & Links for Anti ATAD3A pAb (ATL-HPA065305)
Datasheet Anti ATAD3A pAb (ATL-HPA065305) Datasheet (External Link)
Vendor Page Anti ATAD3A pAb (ATL-HPA065305)