Anti ATAD3A pAb (ATL-HPA065305)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065305-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATAD3A
Alternative Gene Name: FLJ10709
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029036: 95%, ENSRNOG00000018118: 95%
Entrez Gene ID: 55210
Uniprot ID: Q9NVI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRR |
Gene Sequence | KLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRR |
Gene ID - Mouse | ENSMUSG00000029036 |
Gene ID - Rat | ENSRNOG00000018118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATAD3A pAb (ATL-HPA065305) | |
Datasheet | Anti ATAD3A pAb (ATL-HPA065305) Datasheet (External Link) |
Vendor Page | Anti ATAD3A pAb (ATL-HPA065305) at Atlas Antibodies |
Documents & Links for Anti ATAD3A pAb (ATL-HPA065305) | |
Datasheet | Anti ATAD3A pAb (ATL-HPA065305) Datasheet (External Link) |
Vendor Page | Anti ATAD3A pAb (ATL-HPA065305) |